DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33258 and CG13075

DIOPT Version :9

Sequence 1:NP_001034027.2 Gene:CG33258 / 3885664 FlyBaseID:FBgn0053258 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_648831.1 Gene:CG13075 / 39756 FlyBaseID:FBgn0036563 Length:339 Species:Drosophila melanogaster


Alignment Length:258 Identity:131/258 - (50%)
Similarity:174/258 - (67%) Gaps:12/258 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRTLLILAIVFCGLAIVKALECQECLEDNDVYCVDQTSYRNCIKSKPFGNVISCPDDTVCTNSK 65
            |:|.:.::||:.|||:.|.|..||.|||.||||||||.||:||:|:.|.|::|.||..|||:||.
  Fly     1 MQRIIALVAIMACGLSFVAAQSCQTCLEQNDVYCVDQNSYQNCMKNGPVGDIIECPSGTVCSNSD 65

  Fly    66 NVCVKSSDLAESEVDVCGTSGGN--QCATCTN-QKYTCVSKNQFARCSES-VVVDSNIYDCDTDE 126
            :||...|::..:.:||||.||||  ||..|:: .||.|||..|:||||.: .|:.|::|:|.|||
  Fly    66 SVCALISEVNSTILDVCGGSGGNGAQCEVCSSGAKYACVSSTQYARCSSAGDVLTSSVYNCGTDE 130

  Fly   127 ICSSEALEKYDNICTPSCVLDFLDVRATCSNSEY--TTTTTAAPTTVTPSTEQKNSACTEAEKDL 189
            ||..:||..|..:|.|||..:||.:.||||||.|  |||||.|||| |||..||...|...|...
  Fly   131 ICIIDALSTYQTVCVPSCASEFLGLDATCSNSIYQPTTTTTVAPTT-TPSAAQKEDLCNAGEPST 194

  Fly   190 QIPKETLYFFTIYKEDTSCHTYLYCERTESTEWDTVYLSCHQPKPYFDSTTSLCVSTKPTGCS 252
            . |.   ||||...:|::|::||||::: .|.|..:|::|....|:||||||.||:|:||.||
  Fly   195 N-PS---YFFTRITDDSTCNSYLYCQKS-GTTWVALYMTCGASTPFFDSTTSSCVTTRPTSCS 252



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471573
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28I9Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.