DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33258 and CG13308

DIOPT Version :9

Sequence 1:NP_001034027.2 Gene:CG33258 / 3885664 FlyBaseID:FBgn0053258 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_648261.2 Gene:CG13308 / 39011 FlyBaseID:FBgn0035932 Length:233 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:112/270 - (41%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKRTLLILAI-VFCGLAIVKAL----ECQECLEDNDVYCVDQTSYRNCIKSK-PFGNVISCPDDT 59
            |.|.|::||| ||   .:::.|    :|..|...::|.|:..||::.|..|. |.|.|.:||...
  Fly     1 MLRCLILLAIGVF---LVIRILGIRGDCNVCASVSNVACISNTSFQFCSSSALPAGPVYTCPTGY 62

  Fly    60 VCTNSKNVCVKSSDLAESEVDVCGT-SGGNQCATCTNQKYTCVSKNQFARC----SESVVVDS-- 117
            .||.:...|  ::|:|:.....||| ..||        .:.|::...||.|    :.|.:|.|  
  Fly    63 YCTANDVTC--NTDVAQRSCIGCGTCDSGN--------TFACLTARTFALCLGTSTPSQIVGSCG 117

  Fly   118 NIYDCDTDE--ICSSEALEKYDNICTPSCVLDFLDVRATCSNSEYTT---TTTAAPTTVTPSTEQ 177
            :.|.||.:.  ||.|.|...                :|||......|   .|:..|||.      
  Fly   118 SSYVCDFNNPYICGSPAAGS----------------QATCPGDGSGTGLDVTSTTPTTY------ 160

  Fly   178 KNSACTEAEKDLQIPKETLYFFTIYKEDTSCHTYLYCERTESTEWDTVYLSCHQPKPYFDSTTSL 242
                |:..::..:.|    |...:   :|:|..|:|| ...:|.|......| ..:.||:|::..
  Fly   161 ----CSIVQQHGRFP----YGIDL---NTTCRQYIYC-YLNATNWAGGLYYC-PGQTYFNSSSGY 212

  Fly   243 CVSTKPTGCS 252
            |.:..|..|:
  Fly   213 CGTEVPARCT 222



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.