DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33258 and CG13312

DIOPT Version :9

Sequence 1:NP_001034027.2 Gene:CG33258 / 3885664 FlyBaseID:FBgn0053258 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster


Alignment Length:258 Identity:65/258 - (25%)
Similarity:105/258 - (40%) Gaps:37/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILAIVFCGLAIVKALE--CQECLEDNDVYCVDQTSYRNC-IKSKPFGNVISCPDDTVCTNSKN- 66
            |:|.::.|   :|.:..  |..|...|::.|...|..::| :..........||...||.:..: 
  Fly    14 LLLFLLGC---LVSSTHGTCNVCNTVNNLTCYSSTQMQSCQVDVLSTATPTDCPSGYVCVSGSSG 75

  Fly    67 -VCVKSSDLAESEVDVCGTSGGNQCATC-TNQKYTCVSKNQFARCSESVVVDSNIYDCDTDEICS 129
             :|......::|:.| |     .:|..| ..|.:.|.....||.|..:..|..::..|.:..:|:
  Fly    76 VLCQPEDSASDSQAD-C-----QECNKCDETQTFACTGTQSFALCLGTDTVQDSVGTCASGYVCN 134

  Fly   130 SEALEKYDNICTPSCVLDFLDVRATCSNSEYTTTTTAAPTT-----VTPSTEQKNSACTEAEKDL 189
            ...        |..|.|....|..|||.|:.:||||.:.||     ..|||...::.|...:...
  Fly   135 IND--------TQICGLPADGVMPTCSYSDDSTTTTVSSTTSSTTAAPPSTSSASTYCAAVQSQG 191

  Fly   190 QIPKETLYFFTIYKEDTSCHTYLYCERTESTEWDTVYLSCHQPKPYFDSTTSLCVSTKPTGCS 252
            :       :...|...|:|..|:||...:.: |.....:| ....||||.:.:||||.|:.||
  Fly   192 K-------YAVGYNAYTTCRQYIYCTLVDGS-WIGQTYTC-PGSMYFDSASEMCVSTMPSTCS 245



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471581
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005298
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.