| Sequence 1: | NP_001034027.2 | Gene: | CG33258 / 3885664 | FlyBaseID: | FBgn0053258 | Length: | 252 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_729415.2 | Gene: | CG32023 / 317827 | FlyBaseID: | FBgn0052023 | Length: | 160 | Species: | Drosophila melanogaster |
| Alignment Length: | 139 | Identity: | 33/139 - (23%) |
|---|---|---|---|
| Similarity: | 57/139 - (41%) | Gaps: | 11/139 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 ILAIVFCGLAIVKALECQECLEDNDVYCVDQTSYRNCIKSKPFGNVISCPDDTVCTNSKNVCVKS 71
Fly 72 SDLAESEVDVCGTSGGNQCATCTNQ-KYTCVSKNQFARCSESVVVDSNIYDCDTDEICSSEALEK 135
Fly 136 YDNICTPSC 144 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45471613 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0005298 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.840 | |||||