DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34040 and CG10650

DIOPT Version :9

Sequence 1:NP_001033963.1 Gene:CG34040 / 3885655 FlyBaseID:FBgn0054040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001286081.1 Gene:CG10650 / 35162 FlyBaseID:FBgn0046302 Length:425 Species:Drosophila melanogaster


Alignment Length:197 Identity:49/197 - (24%)
Similarity:73/197 - (37%) Gaps:47/197 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TSSYVLASE----KCIYCRDINCQRSSYDAD-------EQCSEKLDA----------------CV 53
            |:....||:    .|:.|....|...:|:.:       |.|:|:..|                |.
  Fly   215 TTEIKCASDSTDPSCLVCNSDFCNSPTYEREAGSCIICENCAEQQVATNAKSCGQAKYNQEVGCY 279

  Fly    54 SVFKAGVIQAQGCLESLEDDWREKCEDKDKGNEIDCEICVTERCNNVAAKRTSCIQCNNTEDAQC 118
            :: .:|....:|||.:||    ..|...:.     |..|....| ||||....||.|.:.|.:.|
  Fly   280 TM-TSGTNVTRGCLNTLE----AGCSTTNA-----CTSCSENGC-NVAAGEFQCITCISNEVSGC 333

  Fly   119 --AESPGLLTAVQCPIARSGRSFCYASLVGDDLKRGCSLTLSD--QVKCLADPNCHLCDPLEQPH 179
              |:.|..|..:.||     ...||:.:..:...|||....|.  |.:|.|....|.|:...:..
  Fly   334 WSAKYPDTLPLINCP-----NGTCYSGVWNELGVRGCFTAASHLMQYQCNAKVEAHQCELCTESK 393

  Fly   180 CN 181
            ||
  Fly   394 CN 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34040NP_001033963.1 DUF753 25..173 CDD:283175 43/174 (25%)
CG10650NP_001286081.1 DUF753 94..234 CDD:283175 5/18 (28%)
DUF753 170..309 CDD:283175 20/103 (19%)
DUF753 277..370 CDD:283175 30/108 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.