DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34040 and CG15170

DIOPT Version :9

Sequence 1:NP_001033963.1 Gene:CG34040 / 3885655 FlyBaseID:FBgn0054040 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_609927.1 Gene:CG15170 / 35160 FlyBaseID:FBgn0032733 Length:561 Species:Drosophila melanogaster


Alignment Length:195 Identity:48/195 - (24%)
Similarity:65/195 - (33%) Gaps:51/195 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KCIYCRD---------INCQRSSYDAD---------------EQCSEKLDACVSVFKAGVIQAQG 65
            ||..|.:         ..|.:.|.|..               |:|.|....||.|.......|:|
  Fly   331 KCYECDEGAGCNSKDFTRCYQCSTDQAGAGCANWESPGEIYIEECDEPAAPCVVVSFNNATTARG 395

  Fly    66 CLESLEDDWREKCEDKDKGNEIDCEICVTERCN--NVAAKRTSCIQCNNTEDAQCAESPGLLTAV 128
            |.:|   |:  .|.   ..|...|.:|....||  :...:|..|.||...:|  |.|.....||:
  Fly   396 CQKS---DF--SCA---SANVASCRLCEGSFCNKGSFPEERLWCHQCRGVQD--CEEISRGQTAM 450

  Fly   129 QCPIARSGRS-----FC--YASLVGDDLKRGCSLTLSDQVKCLADPN----CHLCDPLEQPHCND 182
            .|| ||:...     .|  |..:...::.|||........:||...|    |..|   ....||:
  Fly   451 PCP-ARANEPEDQELACLEYFDINSKEIVRGCRSNPELYYECLLRSNHFDSCRTC---HSQACNN 511

  Fly   183  182
              Fly   512  511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34040NP_001033963.1 DUF753 25..173 CDD:283175 45/184 (24%)
CG15170NP_609927.1 DUF753 35..166 CDD:283175
DUF753 278..416 CDD:283175 21/92 (23%)
DUF753 351..506 CDD:283175 42/168 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21721
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.