powered by:
Protein Alignment CG33981 and Anapc13
DIOPT Version :9
Sequence 1: | NP_001261062.1 |
Gene: | CG33981 / 3885654 |
FlyBaseID: | FBgn0250851 |
Length: | 112 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_852059.1 |
Gene: | Anapc13 / 69010 |
MGIID: | 1916260 |
Length: | 74 |
Species: | Mus musculus |
Alignment Length: | 65 |
Identity: | 31/65 - (47%) |
Similarity: | 45/65 - (69%) |
Gaps: | 0/65 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDSQAPIDDLLLDIVDNAWRMEVLPFDQILVPREKLPDPEADGGDSHLTVSEQEQKWTDLALGSL 65
|||:...|..:||::|:|||.:.||::.:.:|..:||:||.|.|.:..:|.|||.|||||||..|
Mouse 1 MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGGTTESVKEQEMKWTDLALQGL 65
Fly 66 65
Mouse 66 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
73 |
1.000 |
Domainoid score |
I9223 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
73 |
1.000 |
Inparanoid score |
I5275 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG45714 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0007365 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto93388 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_108442 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR28672 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R4900 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X6253 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
11 | 11.000 |
|
Return to query results.
Submit another query.