DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33981 and Anapc13

DIOPT Version :9

Sequence 1:NP_001261062.1 Gene:CG33981 / 3885654 FlyBaseID:FBgn0250851 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001167454.1 Gene:Anapc13 / 685029 RGDID:1583270 Length:74 Species:Rattus norvegicus


Alignment Length:65 Identity:31/65 - (47%)
Similarity:45/65 - (69%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSQAPIDDLLLDIVDNAWRMEVLPFDQILVPREKLPDPEADGGDSHLTVSEQEQKWTDLALGSL 65
            |||:...|..:||::|:|||.:.||::.:.:|..:||:||.|.|.:..:|.|||.|||||||..|
  Rat     1 MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGGTTESVKEQEMKWTDLALQGL 65

  Fly    66  65
              Rat    66  65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33981NP_001261062.1 Apc13p 1..74 CDD:283495 31/65 (48%)
Anapc13NP_001167454.1 Apc13p 1..74 CDD:310437 31/65 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9071
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5197
OMA 1 1.010 - - QHG45714
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007365
OrthoInspector 1 1.000 - - oto96930
orthoMCL 1 0.900 - - OOG6_108442
Panther 1 1.100 - - LDO PTHR28672
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6253
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.