DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33981 and anapc13

DIOPT Version :10

Sequence 1:NP_001261062.1 Gene:CG33981 / 3885654 FlyBaseID:FBgn0250851 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001289714.1 Gene:anapc13 / 569473 ZFINID:ZDB-GENE-091204-298 Length:74 Species:Danio rerio


Alignment Length:65 Identity:31/65 - (47%)
Similarity:44/65 - (67%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSQAPIDDLLLDIVDNAWRMEVLPFDQILVPREKLPDPEADGGDSHLTVSEQEQKWTDLALGSL 65
            |||:...|..:||:.|:|||.:.||::.:.:|..:||:.|.|.|.|..:|.|||.||:||||.||
Zfish     1 MDSEVQRDGRVLDLTDDAWREDRLPYEDVTIPLSELPEAEQDNGGSTESVKEQEMKWSDLALQSL 65

  Fly    66  65
            Zfish    66  65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33981NP_001261062.1 Apc13p 1..74 CDD:310437 31/65 (48%)
anapc13NP_001289714.1 Apc13p 1..73 CDD:310437 31/65 (48%)

Return to query results.
Submit another query.