DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33981 and anapc13

DIOPT Version :9

Sequence 1:NP_001261062.1 Gene:CG33981 / 3885654 FlyBaseID:FBgn0250851 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001289714.1 Gene:anapc13 / 569473 ZFINID:ZDB-GENE-091204-298 Length:74 Species:Danio rerio


Alignment Length:65 Identity:31/65 - (47%)
Similarity:44/65 - (67%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSQAPIDDLLLDIVDNAWRMEVLPFDQILVPREKLPDPEADGGDSHLTVSEQEQKWTDLALGSL 65
            |||:...|..:||:.|:|||.:.||::.:.:|..:||:.|.|.|.|..:|.|||.||:||||.||
Zfish     1 MDSEVQRDGRVLDLTDDAWREDRLPYEDVTIPLSELPEAEQDNGGSTESVKEQEMKWSDLALQSL 65

  Fly    66  65
            Zfish    66  65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33981NP_001261062.1 Apc13p 1..74 CDD:283495 31/65 (48%)
anapc13NP_001289714.1 Apc13p 1..73 CDD:283495 31/65 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9645
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5330
OMA 1 1.010 - - QHG45714
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007365
OrthoInspector 1 1.000 - - oto39756
orthoMCL 1 0.900 - - OOG6_108442
Panther 1 1.100 - - LDO PTHR28672
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4900
SonicParanoid 1 1.000 - - X6253
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.