DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33981 and anapc13.1

DIOPT Version :9

Sequence 1:NP_001261062.1 Gene:CG33981 / 3885654 FlyBaseID:FBgn0250851 Length:112 Species:Drosophila melanogaster
Sequence 2:XP_012823932.1 Gene:anapc13.1 / 549994 XenbaseID:XB-GENE-958927 Length:93 Species:Xenopus tropicalis


Alignment Length:62 Identity:29/62 - (46%)
Similarity:43/62 - (69%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSQAPIDDLLLDIVDNAWRMEVLPFDQILVPREKLPDPEADGGDSHLTVSEQEQKWTDLAL 62
            |||:...|..:||::|:|||.:.||::.:.:|..:||:||.|.|.:..:|.|||.||.||||
 Frog    20 MDSEVLRDGRILDLIDDAWREDKLPYEDVTIPLNELPEPEQDNGGATESVKEQEMKWADLAL 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33981NP_001261062.1 Apc13p 1..74 CDD:283495 29/62 (47%)
anapc13.1XP_012823932.1 Apc13p 20..89 CDD:310437 29/62 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9455
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5159
OMA 1 1.010 - - QHG45714
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007365
OrthoInspector 1 1.000 - - otm48442
Panther 1 1.100 - - LDO PTHR28672
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4900
SonicParanoid 1 1.000 - - X6253
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.