DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33981 and ANAPC13

DIOPT Version :9

Sequence 1:NP_001261062.1 Gene:CG33981 / 3885654 FlyBaseID:FBgn0250851 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001229303.1 Gene:ANAPC13 / 25847 HGNCID:24540 Length:74 Species:Homo sapiens


Alignment Length:62 Identity:30/62 - (48%)
Similarity:44/62 - (70%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSQAPIDDLLLDIVDNAWRMEVLPFDQILVPREKLPDPEADGGDSHLTVSEQEQKWTDLAL 62
            |||:...|..:||::|:|||.:.||::.:.:|..:||:||.|.|.:..:|.|||.|||||||
Human     1 MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLAL 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33981NP_001261062.1 Apc13p 1..74 CDD:283495 30/62 (48%)
ANAPC13NP_001229303.1 Apc13p 1..74 CDD:310437 30/62 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..53 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9403
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5309
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45714
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007365
OrthoInspector 1 1.000 - - oto89817
orthoMCL 1 0.900 - - OOG6_108442
Panther 1 1.100 - - LDO PTHR28672
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4900
SonicParanoid 1 1.000 - - X6253
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.960

Return to query results.
Submit another query.