Sequence 1: | NP_001261062.1 | Gene: | CG33981 / 3885654 | FlyBaseID: | FBgn0250851 | Length: | 112 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001229303.1 | Gene: | ANAPC13 / 25847 | HGNCID: | 24540 | Length: | 74 | Species: | Homo sapiens |
Alignment Length: | 62 | Identity: | 30/62 - (48%) |
---|---|---|---|
Similarity: | 44/62 - (70%) | Gaps: | 0/62 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDSQAPIDDLLLDIVDNAWRMEVLPFDQILVPREKLPDPEADGGDSHLTVSEQEQKWTDLAL 62 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33981 | NP_001261062.1 | Apc13p | 1..74 | CDD:283495 | 30/62 (48%) |
ANAPC13 | NP_001229303.1 | Apc13p | 1..74 | CDD:310437 | 30/62 (48%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 33..53 | 7/19 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 72 | 1.000 | Domainoid score | I9403 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 71 | 1.000 | Inparanoid score | I5309 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG45714 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0007365 | |
OrthoInspector | 1 | 1.000 | - | - | oto89817 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_108442 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR28672 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4900 |
SonicParanoid | 1 | 1.000 | - | - | X6253 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
12 | 11.960 |