powered by:
Protein Alignment CG33981 and anapc13.2
DIOPT Version :9
Sequence 1: | NP_001261062.1 |
Gene: | CG33981 / 3885654 |
FlyBaseID: | FBgn0250851 |
Length: | 112 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002937300.1 |
Gene: | anapc13.2 / 100494390 |
XenbaseID: | XB-GENE-5884825 |
Length: | 74 |
Species: | Xenopus tropicalis |
Alignment Length: | 55 |
Identity: | 24/55 - (43%) |
Similarity: | 37/55 - (67%) |
Gaps: | 0/55 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 DDLLLDIVDNAWRMEVLPFDQILVPREKLPDPEADGGDSHLTVSEQEQKWTDLAL 62
|..:||::|:|||.:.|.::.:.:|..:||.||.|.|.:..:|.|:|.||.||||
Frog 8 DRRILDLIDDAWREDELLYEDVTIPLNELPGPEQDNGWATESVKEEEIKWADLAL 62
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33981 | NP_001261062.1 |
Apc13p |
1..74 |
CDD:283495 |
24/55 (44%) |
anapc13.2 | XP_002937300.1 |
Apc13p |
3..70 |
CDD:310437 |
24/55 (44%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
69 |
1.000 |
Domainoid score |
I9455 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
69 |
1.000 |
Inparanoid score |
I5159 |
OMA |
1 |
1.010 |
- |
- |
|
QHG45714 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0007365 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm48442 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.970 |
|
Return to query results.
Submit another query.