DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33981 and anapc13.2

DIOPT Version :9

Sequence 1:NP_001261062.1 Gene:CG33981 / 3885654 FlyBaseID:FBgn0250851 Length:112 Species:Drosophila melanogaster
Sequence 2:XP_002937300.1 Gene:anapc13.2 / 100494390 XenbaseID:XB-GENE-5884825 Length:74 Species:Xenopus tropicalis


Alignment Length:55 Identity:24/55 - (43%)
Similarity:37/55 - (67%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DDLLLDIVDNAWRMEVLPFDQILVPREKLPDPEADGGDSHLTVSEQEQKWTDLAL 62
            |..:||::|:|||.:.|.::.:.:|..:||.||.|.|.:..:|.|:|.||.||||
 Frog     8 DRRILDLIDDAWREDELLYEDVTIPLNELPGPEQDNGWATESVKEEEIKWADLAL 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33981NP_001261062.1 Apc13p 1..74 CDD:283495 24/55 (44%)
anapc13.2XP_002937300.1 Apc13p 3..70 CDD:310437 24/55 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9455
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5159
OMA 1 1.010 - - QHG45714
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007365
OrthoInspector 1 1.000 - - otm48442
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.