DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34028 and CheA87a

DIOPT Version :10

Sequence 1:NP_001033838.1 Gene:CG34028 / 3885648 FlyBaseID:FBgn0054028 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_650280.1 Gene:CheA87a / 41642 FlyBaseID:FBgn0038142 Length:183 Species:Drosophila melanogaster


Alignment Length:170 Identity:41/170 - (24%)
Similarity:70/170 - (41%) Gaps:28/170 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSKLRMPPLLILVMCCDSIMGGSIRSKQTWTYRIRSTRMATNNESLAGGETHLEREGRGEYTMS 65
            |||.|  .|:..|.:....::..:|..:...|:||:.....|.:.|.......:......|..:|
  Fly     1 MGSSL--CPVSYLAVLAIIVLTSNITVQAKRTFRIQKLEKVTEDTSYLRSRLRIAESEENELKVS 63

  Fly    66 GYLYFNVDIPQDLEGEVNIYRSNDGGATYKLEPYSVPRTVVYHT-----MNTFYKDIV------M 119
            |||..|..:..|....:.:.||.|....|:       :.:.:..     |.::||||.      .
  Fly    64 GYLDLNQRLDNDWTVVLKVSRSPDSDGDYE-------KVLTFEMQLCDFMKSYYKDIFYERIKEY 121

  Fly   120 SSAANCSNFPQFKDKIELIRAQTFTYN----KCLLSPDGF 155
            |:|.:.|:.|..|::..|   :.:.:|    |.|:|| ||
  Fly   122 SNAPHPSSCPLPKERYVL---EDYPFNVKLLKKLMSP-GF 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34028NP_001033838.1 DUF1091 81..166 CDD:461928 22/90 (24%)
CheA87aNP_650280.1 DM8 91..181 CDD:214778 19/78 (24%)

Return to query results.
Submit another query.