DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34028 and CheA75a

DIOPT Version :9

Sequence 1:NP_001033838.1 Gene:CG34028 / 3885648 FlyBaseID:FBgn0054028 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_649035.2 Gene:CheA75a / 40011 FlyBaseID:FBgn0036783 Length:184 Species:Drosophila melanogaster


Alignment Length:169 Identity:38/169 - (22%)
Similarity:62/169 - (36%) Gaps:29/169 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLILVMCCDSIMGGSIRSKQTWTYRIRSTRMATNNESLAGGETHL-----------EREGRGEYT 63
            :::|:...:.|       |...:|.:.:.|:    |...|....|           ||...|.:.
  Fly     6 IIVLLQLLEKI-------KCEQSYEVTNERL----EPFEGDSQTLVLFDGLKTIGRERALNGSFK 59

  Fly    64 MSGYLYFNVDIPQDLEGEVNIYRSNDGGATYKLEPYSVPRTVVYHTMNTFYKDIVMSS--AANCS 126
            ..|.:  |.|   |.:..|.:|.|.:|...:|.....||:|.:......||...|..|  ....:
  Fly    60 FLGEM--NND---DFKVSVELYSSPNGDGEFKRMVMDVPQTSICECFKKFYVQFVQPSLKTGETT 119

  Fly   127 NFPQFKDKIELIRAQTFTYNKCLLSPDGFPTYLPDGIYK 165
            |||...|....:....|.....:|:...:|:.:|.||.|
  Fly   120 NFPVVDDDFCPVPEGEFYVKNVILNTQDWPSQVPRGIVK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34028NP_001033838.1 DUF1091 81..166 CDD:284008 23/87 (26%)
CheA75aNP_649035.2 DM8 85..180 CDD:214778 19/74 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.