DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34028 and CheA86a

DIOPT Version :9

Sequence 1:NP_001033838.1 Gene:CG34028 / 3885648 FlyBaseID:FBgn0054028 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027174.1 Gene:CheA86a / 3772145 FlyBaseID:FBgn0261291 Length:189 Species:Drosophila melanogaster


Alignment Length:130 Identity:32/130 - (24%)
Similarity:49/130 - (37%) Gaps:46/130 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 THLEREGRGEYTMSGYLYFNVDIPQDLEGE-----VNIYRSNDGGATYKLEPYSVPRTVVYHTMN 111
            ::|...|| |..::|    ..:|.:||:.|     |.||.:......|||.|.||||..|.    
  Fly    43 SNLRLIGR-ERILNG----TFEILEDLDDEHFQISVEIYTNPARDGNYKLLPMSVPRQGVC---- 98

  Fly   112 TFYK----------------DIVMSSAA---------------NCSNFPQFKDKIELIRAQTFTY 145
            ||:|                |:.:::.:               |..|:|:...: .|.|...|.|
  Fly    99 TFFKKYGFYFRDCIKNGINTDLFLNTTSCLFPKGHYYLKNVTINVQNWPKIMQR-GLCRHIAFFY 162

  Fly   146  145
              Fly   163  162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34028NP_001033838.1 DUF1091 81..166 CDD:284008 24/101 (24%)
CheA86aNP_001027174.1 DUF1091 <126..174 CDD:301369 7/38 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459073
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.