DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34028 and CheA86a

DIOPT Version :10

Sequence 1:NP_001033838.1 Gene:CG34028 / 3885648 FlyBaseID:FBgn0054028 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027174.1 Gene:CheA86a / 3772145 FlyBaseID:FBgn0261291 Length:189 Species:Drosophila melanogaster


Alignment Length:130 Identity:32/130 - (24%)
Similarity:49/130 - (37%) Gaps:46/130 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 THLEREGRGEYTMSGYLYFNVDIPQDLEGE-----VNIYRSNDGGATYKLEPYSVPRTVVYHTMN 111
            ::|...|| |..::|    ..:|.:||:.|     |.||.:......|||.|.||||..|.    
  Fly    43 SNLRLIGR-ERILNG----TFEILEDLDDEHFQISVEIYTNPARDGNYKLLPMSVPRQGVC---- 98

  Fly   112 TFYK----------------DIVMSSAA---------------NCSNFPQFKDKIELIRAQTFTY 145
            ||:|                |:.:::.:               |..|:|:...: .|.|...|.|
  Fly    99 TFFKKYGFYFRDCIKNGINTDLFLNTTSCLFPKGHYYLKNVTINVQNWPKIMQR-GLCRHIAFFY 162

  Fly   146  145
              Fly   163  162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34028NP_001033838.1 DUF1091 81..166 CDD:461928 24/101 (24%)
CheA86aNP_001027174.1 DUF1091 <126..174 CDD:472716 7/38 (18%)

Return to query results.
Submit another query.