DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34028 and CG18540

DIOPT Version :10

Sequence 1:NP_001033838.1 Gene:CG34028 / 3885648 FlyBaseID:FBgn0054028 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_611316.2 Gene:CG18540 / 37097 FlyBaseID:FBgn0034326 Length:190 Species:Drosophila melanogaster


Alignment Length:41 Identity:13/41 - (31%)
Similarity:17/41 - (41%) Gaps:7/41 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 FPNV-TFIWKYE-SDELDFANNLKNLHFFKWIPQTALLADS 366
            :||. .|:..|. |:...|.|.|.     ||.|:....|.|
  Fly    85 YPNTDCFLICYSISNRTSFDNVLS-----KWYPEIRHFAPS 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34028NP_001033838.1 DUF1091 81..166 CDD:461928
CG18540NP_611316.2 DUF1091 88..164 CDD:461928 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.