DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mitf and CBF1

DIOPT Version :9

Sequence 1:NP_001245436.1 Gene:Mitf / 3885647 FlyBaseID:FBgn0263112 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_012594.1 Gene:CBF1 / 853523 SGDID:S000003821 Length:351 Species:Saccharomyces cerevisiae


Alignment Length:354 Identity:83/354 - (23%)
Similarity:140/354 - (39%) Gaps:71/354 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 HVIQKQKNQVRQYLSESFKPSMWGSHTSEIKLANNSASTGNLQNSSLQKGICDPLERTNRFGCDS 354
            |..:|:.....|..||:.|..      .:..|.:..::.||:.::.|.:|.  .|:.|.......
Yeast    18 HSARKRGYNEEQNYSEARKKQ------RDQGLLSQESNDGNIDSALLSEGA--TLKGTQSQYESG 74

  Fly   355 AVSAKRIMPSDDAMPISPFGGSFVRCDDINPIEPTVLRPNSH-----GAGEPENAHRTAQLGLS- 413
            ..|.|....|||              :|.:..|..|....::     |..:..:||.:.|...: 
Yeast    75 LTSNKDEKGSDD--------------EDASVAEAAVAATVNYTDLIQGQEDSSDAHTSNQTNANG 125

  Fly   414 ----KANSSLSSTRSSSGI-VNSIRISSTSSSLQSTSAPISPSVSSVATSVSEPDDIFDDILQND 473
                ..|...:.|.|:.|: .|:.....|||.::||....:..:..:|.....|:...||   .|
Yeast   126 EHKDSLNGERAITPSNEGVKPNTSLEGMTSSPMESTQQSKNDMLIPLAEHDRGPEHQQDD---ED 187

  Fly   474 SFNFDKNFNSELSIK-----QEPQNLTDAEMNALAKDRQKKDNHNMIERRRRFNINDRIKELGTL 533
            :.:.|.:...::|::     ::|..|...:    ...:|:||:|..:|||||.|||..|..|..|
Yeast   188 NDDADIDLKKDISMQPGRRGRKPTTLATTD----EWKKQRKDSHKEVERRRRENINTAINVLSDL 248

  Fly   534 LPKGSDAFYEVVRDIRPNKGTILKSSVDYIKCLKH------EVTRLRQ--NELRQRQVELQNRKL 590
            ||         ||:  .:|..||..:.:||:.||.      |...|::  :|....|:...|.||
Yeast   249 LP---------VRE--SSKAAILACAAEYIQKLKETDEANIEKWTLQKLLSEQNASQLASANEKL 302

  Fly   591 MSRI----KELEMQ---AKSHGILLSENH 612
            ...:    ||:|..   .:..||...:.|
Yeast   303 QEELGNAYKEIEYMKRVLRKEGIEYEDMH 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MitfNP_001245436.1 MITF_TFEB_C_3_N <272..>311 CDD:292573 6/20 (30%)
HLH 505..570 CDD:238036 26/70 (37%)
CBF1NP_012594.1 HLH 220..272 CDD:238036 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.