DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mitf and Usf1

DIOPT Version :9

Sequence 1:NP_001245436.1 Gene:Mitf / 3885647 FlyBaseID:FBgn0263112 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_113965.1 Gene:Usf1 / 83586 RGDID:620974 Length:310 Species:Rattus norvegicus


Alignment Length:256 Identity:59/256 - (23%)
Similarity:105/256 - (41%) Gaps:51/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 PSDDAMPISPFGGSFVRCDDINPIEPTVLRPNSHGAGEPENAHRTAQLGLSKANSSLSSTRSSSG 427
            |:..:|..:...|:|...|.::            ..|.....|.|.....:..:.|..:|   ||
  Rat    85 PATQSMTQAVIQGAFTSDDAVD------------AEGTAAETHYTYFPSTAVGDGSGGTT---SG 134

  Fly   428 IVNSIRISSTSSSLQSTSAPISPSVSSVATSVSEPDDIFDDILQNDSFNFDKNFNSELSIKQEPQ 492
            ...::..:..|.:|...:.|  ||.......:|.     .::||..|       ...::.:..|.
  Rat   135 STTAVVTTQGSEALLGQATP--PSTGQFFVMMSP-----QEVLQGGS-------QRSIAPRTHPY 185

  Fly   493 NLTDAEMNALAKDRQKKDNHNMIERRRRFNINDRIKELGTLLPKGSDAFYEVVRDIRPNKGTILK 557
            : ..:|.....:|.:::..||.:|||||..||:.|.:|..::|   |...|..:. ..:||.||.
  Rat   186 S-PKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIP---DCSMESTKS-GQSKGGILS 245

  Fly   558 SSVDYIKCLKHEVTRLRQ-----------NELRQRQVE-LQNRKLMSRIKELEMQAKSHGI 606
            .:.|||:.|:....||.:           |::.::||| |:|:.|:     |..|.:.||:
  Rat   246 KACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLL-----LRAQLRHHGL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MitfNP_001245436.1 MITF_TFEB_C_3_N <272..>311 CDD:292573
HLH 505..570 CDD:238036 23/64 (36%)
Usf1NP_113965.1 HLH 200..255 CDD:278439 21/58 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.