DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mitf and USF2

DIOPT Version :9

Sequence 1:NP_001245436.1 Gene:Mitf / 3885647 FlyBaseID:FBgn0263112 Length:837 Species:Drosophila melanogaster
Sequence 2:XP_024307452.1 Gene:USF2 / 7392 HGNCID:12594 Length:397 Species:Homo sapiens


Alignment Length:384 Identity:70/384 - (18%)
Similarity:125/384 - (32%) Gaps:140/384 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 YHVIQKQKNQVRQYLSESFKPSMWGSHTSEIKLANNSASTGNLQNSSLQKGICDPLERTNRFGCD 353
            |.|:|....|:          ...|.....:.:.:.:|..|..|             ...:.|.|
Human    79 YRVVQVTDGQL----------DGQGDTAGAVSVVSTAAFAGGQQ-------------AVTQVGVD 120

  Fly   354 SAVSAKRIMPSDDAMPISPFGGSFVRCDDINPIEPTVLR-PNSHG--------AGEPENAHRTAQ 409
            .|  |:|..|:..::|..|..          |....|:: |.|:|        :||...|:..| 
Human   121 GA--AQRPGPAAASVPPGPAA----------PFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPA- 172

  Fly   410 LGLSKANSSLSSTRSSSGIVNSIRISSTSSSLQSTS---APISPSVSSVATSVSEPDDIFDDILQ 471
                          ||.|...::.:.:|..|||:..   ..::|                .|:||
Human   173 --------------SSVGDTTAVSVQTTDQSLQAGGQFYVMMTP----------------QDVLQ 207

  Fly   472 NDSFNFDKNFNSELSIKQEPQNLTDAEMNALAKDRQKKDNHNMIERRRRFNINDRIKELGTLLP- 535
            ..:       ...::.:..|.: ...:.....:|.:::..||.:|||||..||:.|.:|..::| 
Human   208 TGT-------QRTIAPRTHPYS-PKIDGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPD 264

  Fly   536 -------------------------------KGSDAFYEVVRDIRP---------------NKGT 554
                                           ..|....|.....||               :||.
Human   265 CNADNSKTGAVSTPDPQCLRWSRPPTLACRKSNSHGARESSLGWRPVGGACPKAPGPLAPQSKGG 329

  Fly   555 ILKSSVDYIKCLKHEVTRLRQNELRQRQVELQNRKLMSRIKELE-------MQAKSHGI 606
            ||..:.|||:.|:....|:::......::::.|..|..:|:||:       .|.:.|.:
Human   330 ILSKACDYIRELRQTNQRMQETFKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MitfNP_001245436.1 MITF_TFEB_C_3_N <272..>311 CDD:292573 4/21 (19%)
HLH 505..570 CDD:238036 25/111 (23%)
USF2XP_024307452.1 HLH 233..346 CDD:238036 25/112 (22%)
ZapB 341..>385 CDD:310531 8/43 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.