DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mitf and Usf

DIOPT Version :9

Sequence 1:NP_001245436.1 Gene:Mitf / 3885647 FlyBaseID:FBgn0263112 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_572167.3 Gene:Usf / 31384 FlyBaseID:FBgn0029711 Length:437 Species:Drosophila melanogaster


Alignment Length:397 Identity:87/397 - (21%)
Similarity:152/397 - (38%) Gaps:104/397 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 PQVLQVSTVLENPTRYHVIQKQKNQVRQYLSESFKPSMWGSHTSEIKLANNSASTGN-LQNS--- 334
            |..:.:|..  |||....:....|.....|||:...|.:.:....:.|   ::.||| |.||   
  Fly    26 PSSVNISNA--NPTAGPGLMTITNHHTADLSEALVHSSFANGQQSLIL---TSDTGNPLMNSQGA 85

  Fly   335 SLQKGIC--DPLERTNRF-------GCDSAVSAKRIMPSDDAMPIS---PFGGSFVRCDDINPIE 387
            .:...||  :..:.:..:       |||..:.:  ::||:..:|.:   |.|     |      |
  Fly    86 QIFLTICGDENSDDSQEYYTIKQEPGCDLDIHS--LLPSNLQLPNNLQLPTG-----C------E 137

  Fly   388 PTVLRPNSHGAGEPENAHRTAQLGLSKANSSLS-STRSSSGIVNSIRISSTSSSLQSTSAPISP- 450
            ..:::......|||.          :||...|. .|.|...::.|:..||::.|...|:..::| 
  Fly   138 IYLVKETGSLMGEPP----------TKAAIKLELDTLSEKPLLPSVTTSSSTQSAVITAQTVNPP 192

  Fly   451 ---------SVSSVATSVSEPDDIFDDILQNDSFNFDKNFNSELSIKQEPQNLTDAEMNAL---- 502
                     |.:|..|:.|        :|.....|...:.::....:.:|::......:.|    
  Fly   193 IPGNINTTTSTTSTTTTTS--------VLYGSHGNGHGHGHAHAQARSQPESAGQTPSSKLEAYK 249

  Fly   503 AKDRQKKDNHNMIERRRRFNINDRIKELGTLLP--KGSDAFYEVVRD------------------ 547
            .:|.:::..||.:|||||..||..|.:|..:||  ..|.:|.|....                  
  Fly   250 KRDDKRRATHNEVERRRRDKINSWIFKLKEMLPSLSSSSSFSEASTSPSTSGSTSTNGSSHSKGN 314

  Fly   548 -------IRPN--KGTILKSSVDYIKCLKHEVTRLRQ-----NELRQRQVELQNRKLMSRIK-EL 597
                   ..||  |..||..:.:|||.::.|:..||.     :.||.....|  |:.:.|:| :.
  Fly   315 ASSSSGRAPPNDSKSQILIKACEYIKSMQGEIDTLRDCLRETDSLRASNQAL--REELDRLKRQQ 377

  Fly   598 EMQAKSH 604
            ::|.:.|
  Fly   378 QLQERFH 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MitfNP_001245436.1 MITF_TFEB_C_3_N <272..>311 CDD:292573 9/36 (25%)
HLH 505..570 CDD:238036 25/93 (27%)
UsfNP_572167.3 HLH 255..343 CDD:278439 24/87 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1318
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.