DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and C1galt1

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_443719.3 Gene:C1galt1 / 94192 MGIID:2151071 Length:363 Species:Mus musculus


Alignment Length:334 Identity:122/334 - (36%)
Similarity:179/334 - (53%) Gaps:23/334 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FLVLGIMLGIRLTDFIGYLKLWRNNDLRA--------SEKAALLKYPVASEEH------LATWLR 77
            |.:...:|.|.|.:.........:||..|        |.....:.:...|.:|      :|..|.
Mouse    20 FFLCSQLLSILLREEAAIQPNMLHNDPHARHSDDNGHSHLKGQMNFNADSSQHKDENIDVAENLY 84

  Fly    78 REVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKSESRKNLYAKVRT 142
            ::|:|||.|:|.|.:...||..|..||..||||::||||:.:.:...:.:...|.|:.||.|...
Mouse    85 QKVKILCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENQDFPTVGLKTKEGREQLYWKTIK 149

  Fly   143 GMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGYV 207
            ...|||.|||.:.|||:|||||||::::|||..|..|:||..:|||.|||.|..|||||||.|||
Mouse   150 AFQYVHDHYLEDADWFMKADDDTYVIVDNLRWLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYV 214

  Fly   208 LSRDALRR-LNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNP--FTV 269
            ||::|||| :|.|   .|..|..:...||:.:|.|::.:.|.|||:||..|...|.|..|  ..:
Mouse   215 LSKEALRRFVNAF---KTEKCTHSSSIEDLALGRCMEIINVEAGDSRDTIGKETFHPFVPEHHLI 276

  Fly   270 FPTILSNSWLEGYFFHKPNKS-DCCAASAISFHYVKDFEFELFEFFLYYMRVFG-LHRTPRALPS 332
            ...:....|...|.::.|.:. .||:..|:|||||........|:.:|::|.:| |:|...|||.
Mouse   277 KGYLPKTFWYWNYNYYPPIEGPGCCSDIAVSFHYVDGTTMYELEYLVYHLRPYGYLYRYQPALPE 341

  Fly   333 RLGFRQMNE 341
            .: .:::|:
Mouse   342 NI-LKEINQ 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 72/150 (48%)
C1galt1NP_443719.3 Galactosyl_T 107..>248 CDD:304462 70/143 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844128
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.