DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and AT5G12460

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_568279.2 Gene:AT5G12460 / 831121 AraportID:AT5G12460 Length:441 Species:Arabidopsis thaliana


Alignment Length:172 Identity:43/172 - (25%)
Similarity:66/172 - (38%) Gaps:38/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 NKSESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFK 192
            ||.:::..|:..::.......|    |..||:..||||...::||...|..|:.:...|.|...:
plant   102 NKFKTQIRLFYSLQESFKKASK----ETRWFVIGDDDTLFFLDNLVKALDRYNHKKHYYVGMNSE 162

  Fly   193 AY-------FSQGYMSGGGGYVLSRDALRRLNLFALNSTTICKLNGESEDVQIGHCLQDVGV--- 247
            ..       |..||  |||||.||...:  :.|.:.....|.:..|...|:....||.|:|:   
plant   163 NVWSNAIFAFDMGY--GGGGYALSYPTV--VTLLSNMEECIKRYLGVYSDLLSFRCLADLGIDLT 223

  Fly   248 ---------IAGDTRD-FQGH--------HRFLPVNPFTVFP 271
                     :.||... ...|        |.|..::|  :||
plant   224 LEKGMHQNDLHGDISGLLSAHPQSPLISLHHFDVIDP--IFP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 32/121 (26%)
AT5G12460NP_568279.2 Galactosyl_T <126..>184 CDD:304462 20/59 (34%)
Galactosyl_T 167..416 CDD:304462 26/103 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.