DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and b3glct

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_031751983.1 Gene:b3glct / 780006 XenbaseID:XB-GENE-951583 Length:518 Species:Xenopus tropicalis


Alignment Length:241 Identity:57/241 - (23%)
Similarity:97/241 - (40%) Gaps:51/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PVASEEHLATWLRREVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTD-----SNLNI 124
            ||..|:           :...:.|....|..:..:|.:||..:.....:.|...|     ::|.|
 Frog   285 PVQKED-----------MFVAIKTCRKFHKDRVPVVKKTWEKQATHYEYYSDYADNTIPTADLRI 338

  Fly   125 LQINKSESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGC 189
            ..:.:....|. :|.:...|    :.|:....|.:..||||.|.:..|:..|..|:|..:|:.|.
 Frog   339 PNVERGHCGKT-FAILERFM----ELYVGRMSWLIIVDDDTLISLPRLQKLLGCYNPHQAVFLGE 398

  Fly   190 RFKAYFSQG---YMSGGGGYVLSRDALRRLNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGD 251
            |:......|   |::||||.|.||:|:|||    :||...|..|...:|:.:|.|...:|:....
 Frog   399 RYGYGLQAGGYNYITGGGGMVFSREAVRRL----MNSKCRCYSNDAPDDMVLGMCFSSLGITVTH 459

  Fly   252 T------------RDFQGH------HRFLPVNPFTVFPTILSNSWL 279
            :            :|:..|      |:...::|..|:     ..||
 Frog   460 SPLFHQARPTDYAKDYLAHQIPISFHKHWNIDPIKVY-----YKWL 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 45/157 (29%)
b3glctXP_031751983.1 Fringe 286..489 CDD:367085 52/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.