DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and C1GALT1C1L

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001094800.1 Gene:C1GALT1C1L / 728819 HGNCID:51617 Length:315 Species:Homo sapiens


Alignment Length:287 Identity:81/287 - (28%)
Similarity:130/287 - (45%) Gaps:41/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YLKLWRNNDLRASEKAALLKYPVASEEHLATWLRREVRILCLVLTMPSSHATKAALVNRTWGARC 108
            :|:....||...:.|..||:            |.:.:|:.|::.. .|...:..|::..||...|
Human    44 HLRPPNRNDFLNTSKVILLE------------LSKSIRVFCIIFG-ESEDESYWAVLKETWTKHC 95

  Fly   109 NKLIFMSSQTDSNLNILQINKSESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLR 173
            :|.....::.|:..||    :|..|   :.::||...||.:.|.:.|:||..|...|:.|:|||:
Human    96 DKAELYDTKNDNLFNI----ESNDR---WVQMRTAYKYVFEKYGDNYNWFFLALPTTFAVIENLK 153

  Fly   174 LFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGYVLSRDALRRLNLFALNSTT------ICKLNGE 232
            ..|:..|.....|.| ....:....|::..||.||||:.::|||....||.|      |.||   
Human   154 YLLFTRDASQPFYLG-HTVIFGDLEYVTVEGGIVLSRELMKRLNRLLDNSETCADQSVIWKL--- 214

  Fly   233 SEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNPFTVFPTILSNSWLEGYFFHKPNK--SDCCAA 295
            |||.|:..||:..||.|.:..|::|.         .||.|......:|....:.|.:  ..||:.
Human   215 SEDKQLAICLKYAGVHAENAEDYEGR---------DVFNTKPIAQLIEEALSNNPQQVVEGCCSD 270

  Fly   296 SAISFHYVKDFEFELFEFFLYYMRVFG 322
            .||:|:.:...:.|:..:.||.:|.||
Human   271 MAITFNGLTPQKMEVMMYGLYRLRAFG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 49/155 (32%)
C1GALT1C1LNP_001094800.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153895
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.