DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and C1galt1c1

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_067525.1 Gene:C1galt1c1 / 59048 MGIID:1913493 Length:316 Species:Mus musculus


Alignment Length:309 Identity:85/309 - (27%)
Similarity:144/309 - (46%) Gaps:38/309 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GIMLG---IRLTDFIGYLKL------WRNNDLRASEKAALLKYPVASEEHLATWLRREVRILCLV 86
            |:|||   ..|...:|::::      ..::.|:|..|..:.|...|....|:    :..|:.|:|
Mouse    11 GVMLGSIFCALITMLGHIRIGNRMHHHEHHHLQAPNKDDISKISEAERMELS----KSFRVYCIV 71

  Fly    87 LTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQ-INKSESRKNLYAKVRTGMAYVHKH 150
            |..|...:..|| |..||...|:|..|.||:   |:.:.: ||...:  :::..:|....|.:..
Mouse    72 LVKPKDVSLWAA-VKETWTKHCDKAEFFSSE---NVKVFESINMDTN--DMWLMMRKAYKYAYDQ 130

  Fly   151 YLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGYVLSRDALRR 215
            |.::|:||..|...|:.|:|||:.||...|.....|.|...|:...: |:|..||.|||.::::|
Mouse   131 YRDQYNWFFLARPTTFAVIENLKYFLLKKDQSQPFYLGHTVKSGDLE-YVSVDGGIVLSIESMKR 194

  Fly   216 LNLFALNSTTICKLNGE-----SEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNPFTVFPTILS 275
            ||.. |:....|...|.     |||.|:..||:..||.|.:..|..|.         .||.|...
Mouse   195 LNSL-LSVPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGK---------DVFNTKSV 249

  Fly   276 NSWLEGYFFHKPNK--SDCCAASAISFHYVKDFEFELFEFFLYYMRVFG 322
            ..:::....::||:  ..||:..|::|:.:...:..:..:.:|.:|.||
Mouse   250 GLFIKEAMTNQPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 49/155 (32%)
C1galt1c1NP_067525.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.