DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and CG34452

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001097611.2 Gene:CG34452 / 5740876 FlyBaseID:FBgn0085481 Length:318 Species:Drosophila melanogaster


Alignment Length:356 Identity:105/356 - (29%)
Similarity:171/356 - (48%) Gaps:58/356 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSLFSPKKILQSQYTMILVMIRNIIF-LVLGIMLGIRLTDFIGYLKLWRNNDLRASEKAALLKY 64
            |..|||.:::....        :|.|: |:||.|.      :...|.|.||              
  Fly     1 MPRLFSTRRLFLGG--------KNAIYLLILGTMF------YAVMLHLPRN-------------- 37

  Fly    65 PVASEEHLATWLRREVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLN-ILQIN 128
             ..|.|.:.::.....||.|::.|....|...|..::|||...|:..:|:|...|::|. .:.:|
  Fly    38 -FKSREVVESYGPPPARIFCIISTYAYRHGHAAIHIHRTWVRHCDHYLFVSDDIDNHLEPAVFMN 101

  Fly   129 KSESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKA 193
            ..:.    :.::|..:.||:|::.::.||||..:||.::|::|||..|..|.|:..:||||:.:.
  Fly   102 MPDK----WHRMRAYLEYVYKYHFHQGDWFLYCNDDNFVVVDNLRHMLKTYSPKELIYFGCKLRT 162

  Fly   194 YFSQGYMSGGGGYVLSRDALRRLNLFALNSTTICKLNGESEDV--QIGHCLQDVGVIAGDTRDFQ 256
            .....:|..|.|.|.|..||:|..|.||.:.:||....:..|.  ::|.||.:|.|||||:||..
  Fly   163 TNGLVFMLEGSGIVFSAAALKRFALTALTNESICSSETKGNDFTKELGRCLTNVNVIAGDSRDEF 227

  Fly   257 GHHRFLPVNPFTVFPTILSNSWLEG--YF----FHKPNKSDC-CAASAISFH--YVKDFEFELFE 312
            ..|||||.:......:.::.| ||.  ||    ::..|..:. .:..:|.||  |..:. ::|: 
  Fly   228 QRHRFLPFDADLHLGSSMNES-LENHKYFLDHSYYPVNDMNLPVSLHSICFHVPYTLNI-YDLY- 289

  Fly   313 FFLYYMRVFGLHRTPRALPSRLGFRQMNERL 343
            :|.|..|:||       :|..|||.  |||:
  Fly   290 YFAYKTRIFG-------VPLNLGFE--NERM 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 48/152 (32%)
CG34452NP_001097611.2 Galactosyl_T 72..>183 CDD:304462 36/114 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458875
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.