DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and CG34451

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001369052.1 Gene:CG34451 / 5740612 FlyBaseID:FBgn0085480 Length:307 Species:Drosophila melanogaster


Alignment Length:349 Identity:94/349 - (26%)
Similarity:164/349 - (46%) Gaps:62/349 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SPKKILQSQYTMILVMIRNIIFLVLGIMLGIRLTDFIGYLKLWRNNDLRASEKAALLKYPVASEE 70
            ||:::   .|.:.|.:   |:||:|.:.:.:...|             |...|        .|.:
  Fly     3 SPRRV---YYGLFLAL---ILFLILTLYINVSEVD-------------RKPAK--------RSNQ 40

  Fly    71 HLATWLRREVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLN--ILQINKSESR 133
            |....|..|:||||::....:|..| |..|.||||..||.|:|:|...|..|.  :..||.::: 
  Fly    41 HTLDPLYEEIRILCMIPYNYNSPDT-AKYVKRTWGKHCNVLLFVSGDIDGELEPYVPVINSTDT- 103

  Fly   134 KNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLY--PYDPESSVYFGCRFKAYFS 196
               :..|:.|:...:..|.::.||||:.:..:::|:||||..::  .|.|...:|||...:...:
  Fly   104 ---WTLVQQGLMQAYLFYADQIDWFLRVEPSSFVVLENLRYMIHKRKYQPSQPIYFGYELENIVT 165

  Fly   197 -QGYMSGGGGYVLSRDALRRLNLFALN--STTICKLNGESEDVQIGHCLQDVGVIAGDTRDFQGH 258
             :.::....|||:||:||||..:.:.:  :.......|..|.:.|..||:...|...::||...|
  Fly   166 HESFVHHHSGYVISREALRRYTMASKDPENKECTHWEGYVEGLDIHRCLRFANVTVAESRDEFEH 230

  Fly   259 HRFLPV-------NPFTVFPTILSNSWLEGYFFHK-PNKSDCCAASAISFHYVKDFEFELFE--F 313
            ..||||       |.:...|      ||....:|| ..|:...::.||.|  :.::..|:::  :
  Fly   231 ETFLPVTMDYQFLNGYDTIP------WLRKLSYHKRTEKTVPISSRAICF--LVEYPPEMYDYYY 287

  Fly   314 FLYYMRVFGLHRTPRALPSRLGFR 337
            |:|.:::||   ||  :.:.:.||
  Fly   288 FVYRLKIFG---TP--VRNSIDFR 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 46/156 (29%)
CG34451NP_001369052.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.