DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and si:dkey-202e17.1

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_005170092.1 Gene:si:dkey-202e17.1 / 555344 ZFINID:ZDB-GENE-060503-810 Length:316 Species:Danio rerio


Alignment Length:305 Identity:112/305 - (36%)
Similarity:176/305 - (57%) Gaps:10/305 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RNIIFLVLGIMLGIRLTDFIGYLKLWRNND-LRASEKAALLKYPVASEEHLATWLRREVRILCLV 86
            :|.:|| .|:.:.|.||....:::..|.:. :|.:...:.:|:.||...:......::||:||.|
Zfish     6 QNFLFL-SGVAVSIFLTITYSHVQKTRTSSFVRIARNISTVKHTVAQNRNATLDSSQKVRVLCWV 69

  Fly    87 LTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKSESRKNLYAKVRTGMAYVHKHY 151
            :|.|.:..::...|:.|||.||:.:::|:|: :::...:.:|.||.|..||.|......|:|||:
Zfish    70 MTQPQNLQSRTQHVHATWGKRCDTILYMTSK-NTDFPTIGLNVSEGRNQLYWKTIRAFQYIHKHH 133

  Fly   152 LNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGYVLSRDALRR- 215
            |::.||||||||||::|:||||..|..:..|..:|||.||:.:.:|||||||.|||||::|||| 
Zfish   134 LDDADWFLKADDDTFVVIENLRHSLSKHSSEDPLYFGRRFRPFVAQGYMSGGAGYVLSKEALRRF 198

  Fly   216 LNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNP--FTVFPTILSNSW 278
            :..||   ..:|....|.|||.:|.|::.:.|..||:||..|...|.|..|  :.|........|
Zfish   199 VKGFA---DGLCTHTTELEDVGMGQCMEKMKVEMGDSRDVFGRQVFHPYPPGNYLVRQLRRQRPW 260

  Fly   279 LEGYFFHKPNKS-DCCAASAISFHYVKDFEFELFEFFLYYMRVFG 322
            ...|..:.|.:. .||:..||||||:...|....|::.|::|.:|
Zfish   261 YLIYDHYTPVEGPGCCSDFAISFHYINAVEMHTLEYYTYHLRPYG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 67/150 (45%)
si:dkey-202e17.1XP_005170092.1 Galactosyl_T <139..>229 CDD:304462 47/92 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.