DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and c1galt1c1

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001004886.1 Gene:c1galt1c1 / 448225 XenbaseID:XB-GENE-941230 Length:317 Species:Xenopus tropicalis


Alignment Length:311 Identity:78/311 - (25%)
Similarity:144/311 - (46%) Gaps:41/311 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GIMLG----IRLTDFIGYLKL-------WRNNDLRASEKAALLKYPVASEEHLATWLRREVRILC 84
            |:::|    :.:| .:|::|:       ..::.::|.:|..:.|  ::..|.|.  |...:::.|
 Frog    11 GMLIGGGFCVVIT-LLGHIKVGHEQGISHEHHHIQAPDKEEVKK--LSESERLE--LSHSMQVYC 70

  Fly    85 LVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKSESRKNLYAKVRTGMAYVHK 149
            ::|..|...:..|| |..||...|:|..:.||:.......:.::.::    |:|.:|..:...::
 Frog    71 IILVRPKDLSHWAA-VRETWSKHCDKADYYSSEPMKVFESISVDTND----LWAMMRKAIQMTYE 130

  Fly   150 HYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGYVLSRDALR 214
            :..|.|:||......|:.|:|||:.||...||....|.|...|: ....|:...||.|||.::|.
 Frog   131 NNKNAYNWFFICTPSTFAVIENLKYFLLQKDPSQPYYLGHTVKS-GDLDYVDIAGGIVLSIESLH 194

  Fly   215 RL-NLFALNSTTICKLNG-----ESEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNPFTVFPTI 273
            || ::|  .....|...|     .|||.|:..||:..||:|.:..|.:|.:.|...:..|:....
 Frog   195 RLFSIF--KEPEKCPEQGGLIFKMSEDKQLAMCLKYKGVLAENAEDSEGKNVFNTKSVGTLIQET 257

  Fly   274 LSNSWLEGYFFHKPNK--SDCCAASAISFHYVKDFEFELFEFFLYYMRVFG 322
            ::|:         |.|  ..||:..||:|..:......:..:.:|.:|.:|
 Frog   258 MANN---------PQKVVEGCCSDMAITFSGISPNFMHVMMYGVYRLRAYG 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 45/155 (29%)
c1galt1c1NP_001004886.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.