DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and CG8708

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_610360.2 Gene:CG8708 / 35792 FlyBaseID:FBgn0033271 Length:450 Species:Drosophila melanogaster


Alignment Length:333 Identity:131/333 - (39%)
Similarity:197/333 - (59%) Gaps:22/333 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RNIIFLVLGIMLGIRLTDFIGYL----KLWRNNDLRASEKAALLKYPVASEE------------H 71
            |::..|:.|:::|..|......:    .|:.....|.|:........:|.|:            .
  Fly    21 RSVFTLIAGLVVGYCLAQIFSSIAPHESLYPYLSRRFSDSQVATGGQLAPEQSGLKHDHRNDNVS 85

  Fly    72 LATWLRREVRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNILQINKSESRKNL 136
            :|..|::||||||.|:|.|::|..||..|.||||.|||.|:||||..|..|..::::..|.|:||
  Fly    86 VAEQLKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSGADEELPTVKLDVGEGRENL 150

  Fly   137 YAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMS 201
            :|||:....||:.|:.|:.|:|.|||||||.|:||:|..||||:||:.|:||.:||.:..|||||
  Fly   151 WAKVKEAFKYVYHHHYNDADFFYKADDDTYAVIENMRYMLYPYNPETPVHFGFKFKPFVKQGYMS 215

  Fly   202 GGGGYVLSRDALRRLNLFALNSTTICKLNGE--SEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPV 264
            ||.||:|||:||||..:..:.:..:| |.|.  :||::||.|::::.|.|||:||..|..|..|.
  Fly   216 GGAGYILSREALRRFVVEGIPNPKMC-LPGTVVNEDIEIGRCMENLNVTAGDSRDEIGRGRMFPF 279

  Fly   265 NP-FTVFPTIL-SNSWLEGYFFHKPNKS-DCCAASAISFHYVKDFEFELFEFFLYYMRVFGLHRT 326
            .| ..:.|... .|.|...|.::|.:.. |||:..|||||||....|.:.::.:|:::.:||.|:
  Fly   280 IPEHHLIPAKADKNFWYWNYLYYKTDDGLDCCSDLAISFHYVAPNSFYVLDYLIYHLKPYGLLRS 344

  Fly   327 PRALPSRL 334
            ...||::|
  Fly   345 LEPLPAKL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 77/151 (51%)
CG8708NP_610360.2 MIP-T3 <385..>449 CDD:287245
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458871
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.