DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and CG9109

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster


Alignment Length:272 Identity:58/272 - (21%)
Similarity:89/272 - (32%) Gaps:86/272 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EEHLATWLRRE-------VRILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTD------- 119
            ||.|....||.       ..|...:.|....|..:..::.|||.|......:.|...|       
  Fly   254 EEPLTLGQRRNGCEHTTGSHIYFAIKTCAKFHKERIPIIERTWAADARNRRYYSDVADVGIPAIG 318

  Fly   120 ------------SNLNILQINKSESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENL 172
                        ..:.|||::..:..|.|                 :..|.:..||||.:.:..:
  Fly   319 TGIPNVQTGHCAKTMAILQLSLKDIGKQL-----------------DIRWLMLVDDDTLLSLHLI 366

  Fly   173 RLFLYPYDPESS-----------VYFGCR--FKAYFSQG--YMSGGGGYVLSRDALRRLNLFALN 222
            ...|....|..|           ||.|.|  ::.:...|  |.:||.|.|||...:|     .:.
  Fly   367 HTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNYHTGGAGIVLSLPLVR-----LIV 426

  Fly   223 STTICKLNGESEDVQIGHCLQDVGV----IAG----DTRDFQGH----------HRFLPVNPFTV 269
            ....|......:|:.:|:|||.:||    :||    ..:|:.|.          |:|...:|...
  Fly   427 QRCSCPSASAPDDMILGYCLQALGVPAIHVAGMHQARPQDYAGELLQLHAPLTFHKFWNTDPEHT 491

  Fly   270 FPTILSNSWLEG 281
            :     ..||.|
  Fly   492 Y-----RRWLGG 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 37/183 (20%)
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 49/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.