DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and bus-4

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_500615.2 Gene:bus-4 / 188726 WormBaseID:WBGene00044620 Length:368 Species:Caenorhabditis elegans


Alignment Length:342 Identity:90/342 - (26%)
Similarity:148/342 - (43%) Gaps:67/342 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KILQSQYTMILVMIRNIIFLVLGIMLGIRLTDFIGYLKLWRNND-------------LRASEKAA 60
            ::...:|.:.|:::..|:|.....:..::....|..:.|:..:|             ::.||.| 
 Worm    26 RLCADEYRLSLIIVFIILFFGAYFLYQVQYKTGIDLIPLFPIDDSGFENYNEQLLGSVKVSESA- 89

  Fly    61 LLKYPVASEEHLATWLRREVR---ILCLVLTMPSSHATKAALVNRTWGARC-------NKLIFMS 115
                            |.:.:   :||..:|....|.|:...:..||..||       |...|::
 Worm    90 ----------------RNQAKSGSLLCWAMTTSIYHKTRVPAITETWLRRCDAGHLFTNSDRFLN 138

  Fly   116 SQTDSNLNILQINKSESRKNLYAKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYD 180
            :.|.  .:.:.....||...|:.|.|..:.|::|:...::||:.|.|||||:::|||:.:|...|
 Worm   139 ASTP--YHTVFDGLPESYYKLFWKTRLALLYIYKYVSKDFDWYFKGDDDTYLIVENLQRYLATLD 201

  Fly   181 PESSVYFGCRFKAYFSQGYMSGGGGYVLSRDALRRLNLFA---LNSTTICKLNGESEDVQIGHCL 242
            |....:.|.|.......||.:||.|||:||:|:|   :||   .|....|..: |.||..|..||
 Worm   202 PNKPYFIGYRLSRRTETGYNAGGSGYVMSREAMR---IFAEKLFNDKQKCPYH-EWEDYAIAQCL 262

  Fly   243 QDVGVIAGDTRDFQGHHRFLPVNPFTVFPTILSNS--------WLEGYFFHKPNKSDCCAASAIS 299
            ..||::..|:||.:|..||||..|...|...|:.|        |... .:|:         :.||
 Worm   263 ASVGIVPLDSRDEKGRQRFLPWRPEQHFYADLTRSFQMDPIQVWGPA-IYHE---------NLIS 317

  Fly   300 FHYVKDFEFELFEFFLY 316
            .|::...|..|.:..||
 Worm   318 MHHLHPDEIRLIDGLLY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 52/159 (33%)
bus-4NP_500615.2 Galactosyl_T 104..>235 CDD:304462 43/132 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163314
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.