DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and F56H6.1

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_493101.1 Gene:F56H6.1 / 186412 WormBaseID:WBGene00010162 Length:327 Species:Caenorhabditis elegans


Alignment Length:274 Identity:74/274 - (27%)
Similarity:117/274 - (42%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLNI----LQINKSESRKNLYAKVR 141
            ::.|.|.|....:..:...:..||..:|:...|.:.....|.|:    :.:|..:|..:|:.|..
 Worm    79 QLFCFVETSAVHYDDRVPSIASTWLPKCDNGRFFTKTPLPNSNMTYSTVYLNLKDSYYDLFRKTT 143

  Fly   142 TGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGY 206
            .|..|.:.|....:||:||||||||..|::|:.:|...||...:|.|...|.||..||.|||.||
 Worm   144 FGFYYSYMHISKSFDWYLKADDDTYFAMDHLKEYLSTLDPTKPLYLGYVLKPYFKNGYNSGGSGY 208

  Fly   207 VLSRDALRRLNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNPFTVFP 271
            :||..|::.......:....|..:. :||..:|.|:...|:...||||.:|.:||:|..|..:  
 Worm   209 ILSNAAVKLFVEKLYHDEYTCPYDW-AEDRGMGRCMARAGIFPTDTRDDKGLNRFMPFKPSEL-- 270

  Fly   272 TILSNSWLEGYFFHKPNKSDCCAASAISFHYVKDFEFELFEFFLYYMRVFGLHRTPR-------- 328
                                  |.....:||   :..|..::  ...:...|||.|:        
 Worm   271 ----------------------AGVGPEWHY---YPMEAGQY--ASQKFVSLHRLPQDMMISLDD 308

  Fly   329 ALPSRLGFRQMNER 342
            .|..:||.|..|.:
 Worm   309 ILHPKLGKRVYNPK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 48/153 (31%)
F56H6.1NP_493101.1 Galactosyl_T <127..254 CDD:304462 44/127 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163278
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D555141at33208
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.