DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34057 and Y38C1AB.5

DIOPT Version :9

Sequence 1:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_499851.3 Gene:Y38C1AB.5 / 176819 WormBaseID:WBGene00021407 Length:261 Species:Caenorhabditis elegans


Alignment Length:249 Identity:76/249 - (30%)
Similarity:112/249 - (44%) Gaps:28/249 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 ILCLVLTMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNLN---------ILQINKSESRKNLY 137
            ||||:.|...||.|:|..:..||...|:..:|.   |||.:|         :|     .||.:.:
 Worm    22 ILCLIHTATPSHETRAKTILETWVQHCDDFLFF---TDSKMNDSIPHIYYPLL-----NSRDHSW 78

  Fly   138 AKVRTGMAYVHKHYLNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSG 202
            .|:|....||......:|||:.:||||||.:|.|:|..|..|.|....|.|.::..:..:|: :.
 Worm    79 EKIRRVFKYVRDKITKKYDWYYRADDDTYALMHNMRTLLDNYSPTKHHYLGLQWNFFTPRGF-ND 142

  Fly   203 GGGYVLSRDALRRLNLFALNSTTICKLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHR---FLPV 264
            |..|:|||..:...|...|:.......:...||.::..||..:.:...|.||..|..|   |.|:
 Worm   143 GSSYILSRPTMEAFNEVMLDPDRCPDHHRAEEDQELAKCLAHMEIYPEDIRDEMGSERIQHFHPL 207

  Fly   265 NPFTVFPTILSNSWLEGYFFHK--PNKSDCCAASAISFHYVKDFEFELFEFFLY 316
            ...|::.... |..|..|...|  .|.||    ..||||:|..:|..|.::..|
 Worm   208 EQLTIYKDTF-NRRLAYYPAMKEDENFSD----KMISFHHVSPYEMRLMDYIFY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 46/158 (29%)
Y38C1AB.5NP_499851.3 Galactosyl_T 33..>129 CDD:304462 34/103 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163322
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.710

Return to query results.
Submit another query.