DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and Pi15

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_444421.2 Gene:Pi15 / 94227 MGIID:1934659 Length:269 Species:Mus musculus


Alignment Length:286 Identity:70/286 - (24%)
Similarity:98/286 - (34%) Gaps:77/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LVFLLPETNYCHLKNCPADKKLPHIGCNNSGSWSPKCGKDPKIIDVPKHIKK---------LILN 74
            |:.||.|.:...|.| |.|..||   .||............:..|:||..:|         .||:
Mouse    23 LLSLLCEAHTVVLLN-PTDSSLP---ANNFTDTEAALSTPLESADIPKARRKRYISQNDMIAILD 83

  Fly    75 HHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFSSPSY--H 137
            :||..|..|       .|.||.|..:.||..||..|......|   ..||        .|||  .
Mouse    84 YHNQVRGKV-------FPPAANMEYMVWDENLAKSAEAWAATC---IWDH--------GPSYLLR 130

  Fly   138 AVYNKFKAKEDTFRIVRSQLNAWYDQYKHVS-----------SSSLIDGLSTAKKEIGHFLRMIV 191
            .:......:...:|.:...:..|||:.|..:           .......:.|      |:.:|:.
Mouse   131 FLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCT------HYTQMVW 189

  Fly   192 GPSNRLGCAIASIEK-GGWTHQW-----LACLYSCSPQKNSLLYEYSGKPGVYCTT---GINGK- 246
            ..|||:||||.:.:. ..|...|     |.|.|:   .|.:.:.|...|.||.|::   ...|. 
Mouse   190 ATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYA---PKGNWIGEAPYKVGVPCSSCPPSYGGAC 251

  Fly   247 FQNLCNDTEPVKDCMHSELFQTITAN 272
            ..|||              |..:|.|
Mouse   252 TDNLC--------------FPGVTTN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 41/177 (23%)
Pi15NP_444421.2 SCP_euk 80..223 CDD:240180 40/166 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841171
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.