DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and PRY1

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_012456.1 Gene:PRY1 / 853366 SGDID:S000003615 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:78 Identity:20/78 - (25%)
Similarity:37/78 - (47%) Gaps:14/78 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 LNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYSCS 221
            ::|||::..:...|:  .|.|:   ..|||.:::...:.::||.|.:.  ||....::.|.|  .
Yeast   227 VDAWYNEISNYDFSN--PGFSS---NTGHFTQVVWKSTTQVGCGIKTC--GGAWGDYVICSY--D 282

  Fly   222 PQKNSLLYEYSGK 234
            |..|     |.|:
Yeast   283 PAGN-----YEGE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 15/61 (25%)
PRY1NP_012456.1 CAP_PRY1-like 166..289 CDD:349403 19/75 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344516
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.