DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and AT1G01310

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_171638.2 Gene:AT1G01310 / 839333 AraportID:AT1G01310 Length:241 Species:Arabidopsis thaliana


Alignment Length:86 Identity:22/86 - (25%)
Similarity:37/86 - (43%) Gaps:13/86 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 RSQLNAWYDQYKHVSSSSLIDGLSTAKKEI-GHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACL 217
            |..:|.|.|:.|...    :.|.:...:.: ||:.:::...|.::|||......||   .:..|:
plant   149 RDIVNVWADEDKFYD----VKGNTCEPQHMCGHYTQIVWRDSTKVGCASVDCSNGG---VYAICV 206

  Fly   218 YSCSPQKNSLLYEYSGKPGVY 238
            |  :|..|   ||.....|.|
plant   207 Y--NPPGN---YEGENPFGSY 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 15/65 (23%)
AT1G01310NP_171638.2 SCP_PR-1_like 87..219 CDD:240181 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.