DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and CRISPLD1

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:308 Identity:61/308 - (19%)
Similarity:95/308 - (30%) Gaps:119/308 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRC-------DLQPTDHCISTE 129
            ||:.||..|..|       .|.|:.|..:.||.||...|....:.|       .|.|:   |...
Human    65 ILDLHNKLRSQV-------YPTASNMEYMTWDVELERSAESWAESCLWEHGPASLLPS---IGQN 119

  Fly   130 ------EFSSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVS---------------SSSLI 173
                  .:..|::|                   :.:|||:.|..|               |..:.
Human   120 LGAHWGRYRPPTFH-------------------VQSWYDEVKDFSYPYEHECNPYCPFRCSGPVC 165

  Fly   174 DGLSTAKKEIGHFLRMIVGPSNRLGCAIASIEKGG-WTHQW-----LACLYSCSPQKN---SLLY 229
            .          |:.:::...|||:||||....... |...|     |.|.|  ||:.|   ...|
Human   166 T----------HYTQVVWATSNRIGCAINLCHNMNIWGQIWPKAVYLVCNY--SPKGNWWGHAPY 218

  Fly   230 EYSGKPGVYCTTGINGKF-QNLC----------------NDTEPVKDCMH----------SELFQ 267
            :: |:|...|.....|.. :|||                |:.|..:..:|          |...:
Human   219 KH-GRPCSACPPSFGGGCRENLCYKEGSDRYYPPREEETNEIERQQSQVHDTHVRTRSDDSSRNE 282

  Fly   268 TITANDTTSLIRSMLNRQTQPRTFGWLWNWGKKIWGWVKNAWNAIVGC 315
            .|:|...:.::...:..:.|.:             |...|.:....||
Human   283 VISAQQMSQIVSCEVRLRDQCK-------------GTTCNRYECPAGC 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 38/180 (21%)
CRISPLD1NP_113649.1 SCP_euk 63..207 CDD:240180 39/182 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281 4/26 (15%)
LCCL 291..375 CDD:128866 5/40 (13%)
LCCL 392..483 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151101
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.