DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and AT5G66590

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_201460.1 Gene:AT5G66590 / 836791 AraportID:AT5G66590 Length:185 Species:Arabidopsis thaliana


Alignment Length:199 Identity:39/199 - (19%)
Similarity:64/199 - (32%) Gaps:66/199 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 HELALLATILVKRCDLQPT-----DHCISTEEFSSPSYHA-------VYNKFKAKEDTFRIVRSQ 156
            |.:..:|.:::....:.|.     ...:||.....|:..|       .:||.:|......:|.||
plant     5 HHIIFVALLVISVKAISPAAKLKPKQIVSTSPPPPPTISAAAKAFTDAHNKARAMVGVPPLVWSQ 69

  Fly   157 LNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCAIASIEKG--GWTHQWLACLYS 219
            .                  |..|...:..:.|      |:..|..||:..|  |....|...|.:
plant    70 T------------------LEAAASRLARYQR------NQKKCEFASLNPGKYGANQLWAKGLVA 110

  Fly   220 CSPQKNSLLYEYSGKPGVYCTTGINGK-FQNLCNDTEPVKDCMHSELFQTITANDTTSLIRSMLN 283
            .:|   ||..|          |.:..| |.|..:||     |         .||.|..:.:.::.
plant   111 VTP---SLAVE----------TWVKEKPFYNYKSDT-----C---------AANHTCGVYKQVVW 148

  Fly   284 RQTQ 287
            |.::
plant   149 RNSK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 24/128 (19%)
AT5G66590NP_201460.1 CAP_PR-1 46..185 CDD:349400 32/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.