powered by:
Protein Alignment CG34002 and AT5G26130
DIOPT Version :9
Sequence 1: | NP_001034029.2 |
Gene: | CG34002 / 3885644 |
FlyBaseID: | FBgn0054002 |
Length: | 350 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_197985.2 |
Gene: | AT5G26130 / 832682 |
AraportID: | AT5G26130 |
Length: | 166 |
Species: | Arabidopsis thaliana |
Alignment Length: | 51 |
Identity: | 14/51 - (27%) |
Similarity: | 26/51 - (50%) |
Gaps: | 8/51 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 168 SSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLY 218
:|::..|| |:.||:.:::...|..:|||....:.|| .::.|.|
plant 112 ASNTCSDG-----KQCGHYTQVVWRTSEWVGCAKVKCDNGG---TFVTCNY 154
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.