DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and AT4G33730

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_195099.1 Gene:AT4G33730 / 829515 AraportID:AT4G33730 Length:172 Species:Arabidopsis thaliana


Alignment Length:161 Identity:35/161 - (21%)
Similarity:55/161 - (34%) Gaps:45/161 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LILNHHNTYRDIVAG-----GQMHRLP-----------IAARMLKLKWDHELALLATILVKRCDL 119
            |:|.::.|..|:.:.     .|.|..|           .|.::..|:||..:|.:|.........
plant    13 LLLINYLTQIDVSSAQYSQYPQSHEYPDSYLRPHNAARAAVKVKPLRWDFGIATVAQDYANHLAS 77

  Fly   120 QPTDHCISTEEFSSPSYHAVYNK--------FKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGL 176
            .|   | |.|..|.|     |.:        ..|.:.....|..:  ::||.|.:          
plant    78 GP---C-SLEHSSGP-----YGENLAFGSGDMSAAQAVAMWVHEK--SYYDFYSN---------- 121

  Fly   177 STAKKEIGHFLRMIVGPSNRLGCAIASIEKG 207
            |......||:.:::...|.||||..|....|
plant   122 SCHGPACGHYTQVVWRGSARLGCGKAKCNNG 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 35/161 (22%)
AT4G33730NP_195099.1 CAP_PR-1 39..172 CDD:349400 29/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.