DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and AT4G33720

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_195098.1 Gene:AT4G33720 / 829514 AraportID:AT4G33720 Length:163 Species:Arabidopsis thaliana


Alignment Length:158 Identity:32/158 - (20%)
Similarity:53/158 - (33%) Gaps:53/158 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 HNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKR----CDLQPTDHCISTE-EFSSPS 135
            ||..|..|..|            .|:||.::|..|.....:    |.::.:....... .:||.|
plant    37 HNRARAEVGVG------------PLRWDEKVAAYARNYANQRKGDCAMKHSSGSYGENIAWSSGS 89

  Fly   136 YHAVYNKFKAKEDTFRIVRSQLNAWYDQ---YKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRL 197
            ...|               :.::.|.|:   |.:.|::...|      |:.||:.:::...|.||
plant    90 MTGV---------------AAVDMWVDEQFDYDYDSNTCAWD------KQCGHYTQVVWRNSERL 133

  Fly   198 GCAIASIEK------------GGWTHQW 213
            |||......            |.|..:|
plant   134 GCAKVRCNNGQTFITCNYDPPGNWVGEW 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 32/158 (20%)
AT4G33720NP_195098.1 CAP_PR-1 30..163 CDD:349400 32/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.