DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and AT4G33710

DIOPT Version :10

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_195097.1 Gene:AT4G33710 / 829513 AraportID:AT4G33710 Length:166 Species:Arabidopsis thaliana


Alignment Length:153 Identity:31/153 - (20%)
Similarity:55/153 - (35%) Gaps:48/153 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 LALLATILVKRCDLQPTD--------HCISTEEFSSP--SYHA-----VYNKFKAKEDTFRIVRS 155
            |..||.:|.....|:..|        |..:.::.|.|  .:||     .:|..:.::...|::.|
plant    12 LLALALVLAFAVPLKAQDRRQDYLDVHNHARDDVSVPHIKWHAGAARYAWNYAQRRKRDCRLIHS 76

  Fly   156 QLNAWYDQ------------------------YKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNR 196
            .....|.:                        |.|.|::      ..|.|:.||:.:::...|..
plant    77 NSRGRYGENLAWSSGDMSGAAAVRLWVREKSDYFHKSNT------CRAGKQCGHYTQVVWKNSEW 135

  Fly   197 LGCAIASIEKGGWTHQWLACLYS 219
            :|||....:.||   .::.|.||
plant   136 VGCAKVKCDNGG---TFVTCNYS 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 CAP_euk 69..219 CDD:349399 29/151 (19%)
AT4G33710NP_195097.1 CAP_PR-1 32..166 CDD:349400 25/133 (19%)

Return to query results.
Submit another query.