DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and AT4G30320

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_194761.1 Gene:AT4G30320 / 829155 AraportID:AT4G30320 Length:161 Species:Arabidopsis thaliana


Alignment Length:177 Identity:39/177 - (22%)
Similarity:66/177 - (37%) Gaps:32/177 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PKIIDVPKHIKKLILN--HHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILV--KRCDL 119
            |..:.|......|::.  |..||::...|.| :......|:..||||.:||..|....  :|.|.
plant     4 PSCVSVAITAMMLLVTCCHCATYQEQFMGPQ-NAARAHLRLKPLKWDAKLARYAQWWANQRRGDC 67

  Fly   120 QPTDHCISTEEFSSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQ---YKHVSSSSLIDGLSTAKK 181
            ..|.   |...:....:....|::...:..:        .|..:   |.:.|:|        ...
plant    68 ALTH---SNGPYGENLFWGSGNRWGPSQAAY--------GWLSEARSYNYRSNS--------CNS 113

  Fly   182 EI-GHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYSCSPQKNSL 227
            |: ||:.:::...:.::|||......||..  :|.|.|  .|..|.|
plant   114 EMCGHYTQIVWKNTQKIGCAHVICNGGGGV--FLTCNY--DPPGNFL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 33/157 (21%)
AT4G30320NP_194761.1 CAP_PR-1 27..161 CDD:349400 33/154 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.