DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and AT4G25790

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_194309.1 Gene:AT4G25790 / 828684 AraportID:AT4G25790 Length:210 Species:Arabidopsis thaliana


Alignment Length:166 Identity:45/166 - (27%)
Similarity:67/166 - (40%) Gaps:38/166 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILV--KRCDLQPTDHCISTEEFSSPS 135
            |:.|||.|    ||.  .||      .|.||.::|..||...  :|.|...|.   ||..:....
plant    79 LDPHNTVR----GGL--GLP------PLVWDVKIASYATWWANQRRYDCSLTH---STGPYGENL 128

  Fly   136 YHAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCA 200
            :....:.|.:   ||.:....:.|  ..|.|::::...||:      .||:.:::...:.|||||
plant   129 FWGSGSDFTS---TFAVESWTVEA--KSYNHMTNTCEGDGM------CGHYTQIVWRETRRLGCA 182

  Fly   201 IASIEKGGWTHQWLACLYSCSPQKNSLLYEYSG-KP 235
            ....|.|...  ::.|.|  .|..|     |.| ||
plant   183 RVVCENGAGV--FITCNY--DPPGN-----YVGEKP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 38/147 (26%)
AT4G25790NP_194309.1 CAP_PR-1 76..210 CDD:349400 45/166 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.