powered by:
Protein Alignment CG34002 and AT4G07820
DIOPT Version :9
Sequence 1: | NP_001034029.2 |
Gene: | CG34002 / 3885644 |
FlyBaseID: | FBgn0054002 |
Length: | 350 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_192524.1 |
Gene: | AT4G07820 / 826263 |
AraportID: | AT4G07820 |
Length: | 160 |
Species: | Arabidopsis thaliana |
Alignment Length: | 47 |
Identity: | 15/47 - (31%) |
Similarity: | 20/47 - (42%) |
Gaps: | 10/47 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 TNYCHL-KNCPADK-----KLPHIGCN----NSGSWSPKCGKDPKII 62
||.|.. |:|...| |...:||. |:|.:...|..||.:|
plant 108 TNTCRAGKSCDGYKQVLFRKSVFLGCAKVKCNNGGFLAICSYDPSVI 154
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34002 | NP_001034029.2 |
SCP_euk |
69..219 |
CDD:240180 |
|
AT4G07820 | NP_192524.1 |
CAP_PR-1 |
29..160 |
CDD:349400 |
15/47 (32%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.