DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and AT3G09590

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_187570.1 Gene:AT3G09590 / 820116 AraportID:AT3G09590 Length:186 Species:Arabidopsis thaliana


Alignment Length:170 Identity:33/170 - (19%)
Similarity:62/170 - (36%) Gaps:38/170 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKRCDLQPTDHCISTEEFS 132
            :.:..|..||..|            :::.:..|.||.:||..|....|    |....|.......
plant    49 LSREFLQAHNDAR------------VSSGVPTLGWDRDLARFADKWAK----QRKSDCSMIHSGG 97

  Fly   133 SPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQYKH--VSSSSLIDGLSTAKKEIGHFLRMIVGPSN 195
            ....:..:::.|......::|    ..|:::..:  |.:::...|     |..||:.:|:...:.
plant    98 PYGENIFWHRRKKTWSPEKVV----TRWFEERFNYDVKTNTCAPG-----KMCGHYTQMVWRETT 153

  Fly   196 RLGCAIASIEKG-GWTHQWLACLYSCSPQKNSLLYEYSGK 234
            .:|||......| |:.   :.|.|  .|:.|     |.|:
plant   154 AVGCARVKCHNGRGYL---VVCEY--DPRGN-----YEGE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 28/152 (18%)
AT3G09590NP_187570.1 CAP_PR-1 50..186 CDD:349400 33/169 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.