powered by:
Protein Alignment CG34002 and PR-1-LIKE
DIOPT Version :9
Sequence 1: | NP_001034029.2 |
Gene: | CG34002 / 3885644 |
FlyBaseID: | FBgn0054002 |
Length: | 350 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_179589.1 |
Gene: | PR-1-LIKE / 816518 |
AraportID: | AT2G19990 |
Length: | 176 |
Species: | Arabidopsis thaliana |
Alignment Length: | 57 |
Identity: | 16/57 - (28%) |
Similarity: | 28/57 - (49%) |
Gaps: | 8/57 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 162 DQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLY 218
:.|.:.|::...||: .||:.:::...|.|||| ||:......:.|:.|.|
plant 116 ENYDYDSNTCGGDGV------CGHYTQIVWRDSVRLGC--ASVRCKNDEYIWVICSY 164
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.