DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and AT2G19970

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_179587.1 Gene:AT2G19970 / 816516 AraportID:AT2G19970 Length:177 Species:Arabidopsis thaliana


Alignment Length:199 Identity:35/199 - (17%)
Similarity:55/199 - (27%) Gaps:92/199 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PKIIDVPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKR------C 117
            |::..:.....:..|..||..|            .|..:..|||:..:|..|.....|      |
plant    25 PRVRPIKDVQPRKTLKVHNQIR------------AAVGVAPLKWNKTVAAYAQKFANRQAKAGVC 77

  Fly   118 D-------------------LQPTDHCISTEEFSSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQ 163
            |                   :||.|      :.|.|    :..|:                |..:
plant    78 DYSSMRHSDGPYGENIAAGWVQPKD------QMSGP----IAAKY----------------WLTE 116

  Fly   164 ---YKHVSSSSLIDGLSTAKKEIGHFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLYSCSPQKN 225
               |.|.::.        .|...||:.:|:...|..|||.                .:.|  .:|
plant   117 KPNYDHATNK--------CKDVCGHYTQMVANQSLSLGCG----------------SFRC--HEN 155

  Fly   226 SLLY 229
            .|:|
plant   156 ELIY 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 30/177 (17%)
AT2G19970NP_179587.1 CAP_PR-1 35..177 CDD:349400 34/189 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.