DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34002 and PR1

DIOPT Version :9

Sequence 1:NP_001034029.2 Gene:CG34002 / 3885644 FlyBaseID:FBgn0054002 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_179068.1 Gene:PR1 / 815949 AraportID:AT2G14610 Length:161 Species:Arabidopsis thaliana


Alignment Length:161 Identity:34/161 - (21%)
Similarity:55/161 - (34%) Gaps:48/161 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LNHHNTYRDIVAGGQMHRLPIAARMLKLKWDHELALLATILVKR----CDL----QPTDHCISTE 129
            |..||..|..|..|.|            :||..:|..|....::    |.|    .|....::  
plant    34 LRVHNQARGAVGVGPM------------QWDERVAAYARSYAEQLRGNCRLIHSGGPYGENLA-- 84

  Fly   130 EFSSPSYHAVYNKFKAKEDTFRIVRSQLNAWYDQYKHVSSSSLIDGLSTAKKEIGHFLRMIVGPS 194
             :.|.....|               |.:|.|..:..:.:.::     :|.....||:.:::...|
plant    85 -WGSGDLSGV---------------SAVNMWVSEKANYNYAA-----NTCNGVCGHYTQVVWRKS 128

  Fly   195 NRLGCAIASIEKGGWTHQWLACLYSCSPQKN 225
            .|||||......||..   ::|.|  .|:.|
plant   129 VRLGCAKVRCNNGGTI---ISCNY--DPRGN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34002NP_001034029.2 SCP_euk 69..219 CDD:240180 31/153 (20%)
PR1NP_179068.1 SCP_PR-1_like 30..161 CDD:240181 34/161 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.